Arenicin-1 vs Statherin

Head-to-head comparison of Arenicin-1 (Arenicin-1) and Statherin (Human statherin) — benefits, dosing, side effects, research data, and where to buy.

Research Score

PropertyArenicin-1Statherin
CategoryMarine-DerivedDental & Oral
Full NameArenicin-1Human statherin
Molecular Weight2079 Da5380 Da
Half-Lifen/aminutes to hours in saliva
Amino Acids2143
Typical Dosen/a1-50 µM in experimental systems
RoutepreclinicalTopical/Intraoral
Purity≥98%≥98%
Studies Count7695
Research StatusPre-clinicalPre-clinical

Arenicin-1 Benefits

  • antimicrobial
  • anti-biofilm
  • membrane-active

Statherin Benefits

  • enamel pellicle stabilization
  • calcium phosphate homeostasis
  • remineralization support
  • anti-adhesion

Arenicin-1 Dosing

bacterial infection|biofilm disruption

Statherin Dosing

topical peptide exposure in vitro or ex vivo|salivary-mimetic coating studies|surface-conditioning protocols

Arenicin-1 Side Effects

  • Arenicola marina

Statherin Side Effects

  • minimal systemic effects expected
  • surface adsorption variability
  • rapid enzymatic breakdown

Research Overview

Arenicin-1

Marine annelid peptide with strong preclinical antibacterial activity and a stable structural motif that is useful for peptide engineering.

Statherin

Statherin has been extensively studied as a key regulator of enamel mineral equilibrium and pellicle biology. It is used in biomimetic dentistry research to model or improve enamel protection and remineralization.

Ready to buy?

Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.

Common Stacking Partners

Arenicin-1 stacks with:

Arenicola marinabeta-hairpinantibiotic

Statherin stacks with:

fluorideCPP-ACPhydroxyapatite
marine-derivedbioactiveantimicrobial peptidebiofilmsalivary-peptideenamelpellicleremineralization