Arenicin-1 vs GLP-1(7-36) amide
Head-to-head comparison of Arenicin-1 (Arenicin-1) and GLP-1(7-36) amide (Glucagon-like peptide-1 (7-36) amide) — benefits, dosing, side effects, research data, and where to buy.
Research Score
| Property | Arenicin-1 | GLP-1(7-36) amide |
|---|---|---|
| Category | Marine-Derived | Endocrine Peptides |
| Full Name | Arenicin-1 | Glucagon-like peptide-1 (7-36) amide |
| Molecular Weight | 2079 Da | 3297.7 Da |
| Half-Life | n/a | 1-2 min |
| Amino Acids | 21 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Typical Dose | n/a | pM-nM physiologic range|research-dependent |
| Route | preclinical | endogenous secretion|SC/IV in research/clinical analog studies |
| Purity | ≥98% | ≥98% |
| Studies Count | 76 | 99 |
| Research Status | Pre-clinical | Endogenous |
Arenicin-1 Benefits
- ✓antimicrobial
- ✓anti-biofilm
- ✓membrane-active
GLP-1(7-36) amide Benefits
- ✓glucose-dependent insulin secretion
- ✓gastric emptying delay
- ✓satiety signaling
Arenicin-1 Dosing
bacterial infection|biofilm disruption
GLP-1(7-36) amide Dosing
physiologic secretion|research-dependent
Arenicin-1 Side Effects
- ⚠Arenicola marina
GLP-1(7-36) amide Side Effects
- ⚠nausea
- ⚠fullness
- ⚠reduced appetite
Research Overview
Arenicin-1
Marine annelid peptide with strong preclinical antibacterial activity and a stable structural motif that is useful for peptide engineering.
GLP-1(7-36) amide
One of the best-studied gut hormones, with strong evidence for incretin biology and appetite regulation. Native GLP-1 is rapidly degraded by DPP-4, which is why its biology is central to endocrine and metabolic pharmacology.
Ready to buy?
Find both peptides from our verified, lab-tested vendors with purity certificates and third-party testing.
Related Comparisons
Arenicin-1 vs Piscidin-3Marine-DerivedArenicin-1 vs Clavanin AMarine-DerivedArenicin-1 vs PleurocidinMarine-DerivedArenicin-1 vs Epinecidin-1Marine-DerivedGLP-1(7-36) amide vs Cholecystokinin-8Endocrine PeptidesGLP-1(7-36) amide vs Atrial Natriuretic Peptide (ANP-28)Endocrine PeptidesGLP-1(7-36) amide vs B-Type Natriuretic Peptide (BNP-32)Endocrine PeptidesGLP-1(7-36) amide vs C-Type Natriuretic Peptide (CNP-22)Endocrine Peptides
Common Stacking Partners
Arenicin-1 stacks with:
Arenicola marinabeta-hairpinantibiotic
GLP-1(7-36) amide stacks with:
L-cellsinsulinsatiety
marine-derivedbioactiveantimicrobial peptidebiofilmgut-hormoneincretinendocrine-peptide